Web Analysis for Uevf - uevf.org
Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat
2.50
Rating by CuteStat
uevf.org is 5 years 11 months old. It is a domain having org extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, uevf.org is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
No Risk Issues
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 18,200 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 26 | H4 Headings: | 13 |
H5 Headings: | 8 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 53 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 104.28.23.33)
Instagramers.com | Web for instagram addicts | Tips Apps iPhone Hipsta
- instagramers.com
1,023,359
$
1,200.00
سهامداران پدیده شاندیز و پدیده کیش
- shandizstocks.ir
سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند
30,640
$
271,440.00
Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100
- centralpennsylvaniatrafficlawyers.com
Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Wed, 11 Dec 2019 18:30:41 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.6.35
Link: <https://uevf.org/wp-json/>; rel="https://api.w.org/"
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 543987fc8b5f1ebd-SJC
Content-Encoding: gzip
Date: Wed, 11 Dec 2019 18:30:41 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Powered-By: PHP/5.6.35
Link: <https://uevf.org/wp-json/>; rel="https://api.w.org/"
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 543987fc8b5f1ebd-SJC
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
art.ns.cloudflare.com | 173.245.59.102 | United States of America | |
abby.ns.cloudflare.com | 108.162.192.100 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
uevf.org | A | 300 |
IP: 104.28.22.33 |
uevf.org | A | 300 |
IP: 104.28.23.33 |
uevf.org | NS | 86400 |
Target: abby.ns.cloudflare.com |
uevf.org | NS | 86400 |
Target: art.ns.cloudflare.com |
uevf.org | SOA | 3600 |
MNAME: abby.ns.cloudflare.com RNAME: dns.cloudflare.com Serial: 2031178078 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600 |
uevf.org | MX | 300 |
Priority: 1 Target: mx1.emailowl.com |
uevf.org | TXT | 300 |
TXT: google-site-verification=OZgdJudztiPu2wz XJagJA-IRP7CdYwitwDXuR6zyyEo |
uevf.org | TXT | 300 |
TXT: ca3-baefadc41f8a4f46a5577ba811ec73d8 |
uevf.org | AAAA | 300 |
IPV6: 2606:4700:30::681c:1621 |
uevf.org | AAAA | 300 |
IPV6: 2606:4700:30::681c:1721 |
Full WHOIS Lookup
Domain Name: uevf.org
Registry Domain ID: D402200000006263958-LROR
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: https://www.namesilo.com/
Updated Date: 2019-11-29T07:00:00Z
Creation Date: 2018-05-24T07:00:00Z
Registrar Registration Expiration Date: 2020-05-24T07:00:00Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: abuse@namesilo.com
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: See PrivacyGuardian.org
Registrant Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Registrant City: Phoenix
Registrant State/Province: AZ
Registrant Postal Code: 85016
Registrant Country: US
Registrant Phone: +1.3478717726
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Registry Admin ID:
Admin Name: Domain Administrator
Admin Organization: See PrivacyGuardian.org
Admin Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Admin City: Phoenix
Admin State/Province: AZ
Admin Postal Code: 85016
Admin Country: US
Admin Phone: +1.3478717726
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Registry Tech ID:
Tech Name: Domain Administrator
Tech Organization: See PrivacyGuardian.org
Tech Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Tech City: Phoenix
Tech State/Province: AZ
Tech Postal Code: 85016
Tech Country: US
Tech Phone: +1.3478717726
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Name Server: abby.ns.cloudflare.com
Name Server: art.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-11T07:00:00Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE AND TERMS OF USE: You are not authorized to access or query our WHOIS
database through the use of high-volume, automated, electronic processes. The
Data in our WHOIS database is provided for information purposes only, and to
assist persons in obtaining information about or related to a domain name
registration record. We do not guarantee its accuracy. By submitting a WHOIS
query, you agree to abide by the following terms of use: You agree that you may
use this Data only for lawful purposes and that under no circumstances will you
use this Data to: (1) allow, enable, or otherwise support the transmission of
mass unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes that
apply to us (or our computer systems). The compilation, repackaging,
dissemination or other use of this Data is expressly prohibited without our
prior written consent. We reserve the right to terminate your access to the
WHOIS database at our sole discretion, including without limitation, for
excessive querying of the WHOIS database or for failure to otherwise abide by
this policy. We reserve the right to modify these terms at any time.
Domains - cheap, easy, and secure at NameSilo.com
https://www.namesilo.com
Register your domain now at www.NameSilo.com - Domains. Cheap, Fast and Secure
Registry Domain ID: D402200000006263958-LROR
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: https://www.namesilo.com/
Updated Date: 2019-11-29T07:00:00Z
Creation Date: 2018-05-24T07:00:00Z
Registrar Registration Expiration Date: 2020-05-24T07:00:00Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: abuse@namesilo.com
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Domain Administrator
Registrant Organization: See PrivacyGuardian.org
Registrant Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Registrant City: Phoenix
Registrant State/Province: AZ
Registrant Postal Code: 85016
Registrant Country: US
Registrant Phone: +1.3478717726
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Registry Admin ID:
Admin Name: Domain Administrator
Admin Organization: See PrivacyGuardian.org
Admin Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Admin City: Phoenix
Admin State/Province: AZ
Admin Postal Code: 85016
Admin Country: US
Admin Phone: +1.3478717726
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Registry Tech ID:
Tech Name: Domain Administrator
Tech Organization: See PrivacyGuardian.org
Tech Street: 1928 E. Highland Ave. Ste F104 PMB# 255
Tech City: Phoenix
Tech State/Province: AZ
Tech Postal Code: 85016
Tech Country: US
Tech Phone: +1.3478717726
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: pw-da750a466302165963a215030b01af64@privacyguardian.org
Name Server: abby.ns.cloudflare.com
Name Server: art.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-11T07:00:00Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE AND TERMS OF USE: You are not authorized to access or query our WHOIS
database through the use of high-volume, automated, electronic processes. The
Data in our WHOIS database is provided for information purposes only, and to
assist persons in obtaining information about or related to a domain name
registration record. We do not guarantee its accuracy. By submitting a WHOIS
query, you agree to abide by the following terms of use: You agree that you may
use this Data only for lawful purposes and that under no circumstances will you
use this Data to: (1) allow, enable, or otherwise support the transmission of
mass unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes that
apply to us (or our computer systems). The compilation, repackaging,
dissemination or other use of this Data is expressly prohibited without our
prior written consent. We reserve the right to terminate your access to the
WHOIS database at our sole discretion, including without limitation, for
excessive querying of the WHOIS database or for failure to otherwise abide by
this policy. We reserve the right to modify these terms at any time.
Domains - cheap, easy, and secure at NameSilo.com
https://www.namesilo.com
Register your domain now at www.NameSilo.com - Domains. Cheap, Fast and Secure